PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05551g03011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 324aa    MW: 35881.9 Da    PI: 6.7806
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05551g03011.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.58.1e-4056116262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               +++++kcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  Niben101Scf05551g03011.1  56 HDHSVKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 116
                               57889*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2950110IPR003851Zinc finger, Dof-type
PfamPF027012.7E-3358114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.99460114IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGITSLQVCM DSSDWLQGTI HEEGAAGIDS SSSPISEDIL TCSRPLIVER RLRPPHDHSV  60
KCPRCDSTHT KFCYYNNYSL SQPRYFCKTC RRYWTKGGTL RNIPVGGGCR KNKKVSSKKS  120
NIETANNQNP TDLQLSFPDN MPPFSHHHFM SSNNFGLGNH QGNNFMLENN TPIDFMESKY  180
EALVGCTSSR NQDFPGNGDI GMISTPTGFG HDINSHGNII APNFAFGMAT MDAGNNFGTT  240
EMNSSHHHQR LMLSNYENNQ HEEQIINAVV KPNPKILSLE WHDQLQGCSD AGKESFSYYS  300
IVGGLGSWTG LVNDYGSSAT NPLV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009765174.10.0PREDICTED: dof zinc finger protein DOF5.6-like
RefseqXP_016451922.10.0PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM033e-50DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A061FUJ41e-114A0A061FUJ4_THECC; F-box family protein isoform 2 (Fragment)
TrEMBLA0A061FV521e-114A0A061FV52_THECC; Dof-type zinc finger DNA-binding family protein isoform 1
STRINGPGSC0003DMT4000465981e-111(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48952240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.13e-45Dof family protein